C1orf151 Antibody - middle region

Référence ARP44801_P050-25UL

Conditionnement : 25ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-MINOS1 (ARP44801_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C1orf151
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-MINOS1 (ARP44801_P050) antibody is Catalog # AAP44801 (Previous Catalog # AAPP12277)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceGregory,S.G., (2006) Nature 441 (7091), 315-321
Publications

A novel homozygous variant in MICOS13/QIL1 causes hepato-encephalopathy with mitochondrial DNA depletion syndrome. Mol Genet Genomic Med. 8, e1427 (2020). 32749073

Accessory subunits are integral for assembly and function of human mitochondrial complex I. Nature. 538, 123-126 (2016). 27626371

Dissecting the Roles of Mitochondrial Complex I Intermediate Assembly Complex Factors in the Biogenesis of Complex I. Cell Rep. 31, 107541 (2020). 32320651

FAM92A1 is a BAR domain protein required for mitochondrial ultrastructure and function. J Cell Biol. 218, 97-111 (2019). 30404948

Jans, D. C. et al. STED super-resolution microscopy reveals an array of MINOS clusters along human mitochondria. Proc. Natl. Acad. Sci. U. S. A. 110, 8936-41 (2013). 23676277

Mitochondrial hepato-encephalopathy due to deficiency of QIL1/MIC13 (C19orf70), a MICOS complex subunit. Eur J Hum Genet. 24, 1778-1782 (2016). 27485409

Gene SymbolMINOS1
Gene Full NameMitochondrial inner membrane organizing system 1
Alias SymbolsMIO10, Mic10, MINOS1, C1orf151
NCBI Gene Id440574
Protein NameMitochondrial inner membrane organizing system protein 1
Description of TargetThe exact function of C1orf151 remains unknown.
Uniprot IDQ5TGZ0
Protein Accession #NP_001027535
Nucleotide Accession #NM_001032363
Protein Size (# AA)78
Molecular Weight9 kDa
Protein InteractionsMIA3; GSTK1; IBA57; RDH13; COA7; DNAJC11; CHCHD3; RMDN1; SAMM50; ACOT9; IMMT; TUBGCP2; MTHFD2; MTX2; TUBG1; MAPK1; MTX1; HSPA9; GDI1; FECH; ACSL4; C1QBP;
  1. What is the species homology for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "C1orf151 Antibody - middle region (ARP44801_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C1orf151 Antibody - middle region (ARP44801_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    This target may also be called "MIO10, Mic10, MINOS1, C1orf151" in publications.

  5. What is the shipping cost for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "9 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C1orf151 Antibody - middle region (ARP44801_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MINOS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MINOS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MINOS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MINOS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MINOS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MINOS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
0100-20
 20mL 
0100-01
 25mL