C5a, Mouse, Recombinant

Référence HC1101-50UG

Conditionnement : 50ug

Marque : Hycult biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

C5a, Mouse, Recombinant

Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a.
Recombinant mouse C5a is His-Tagged and has the following amino acid sequence:
MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIAFNECCTIANKIRKESPHKPVQLGR.

The molecular weight of the protein is 12 kg/mol.

Use
For dilutions use protein stabilized phosphate buffered saline, pH 7.4.

Product type
Proteins
Amount
50 µg
Species
Mouse
Alias
Pam3Cys-Ser-(Lys)4 x 3 HCl, Pam3Cys-SK4 x 3 HCl, P3CSK4 x 3 HCl
Formulation
Lyophilized product in 0.005% Tween 80, 2mM reduced L-glutathion, 0.2mM oxidized L-glutathion and 0.1M Tris-Cl buffer, pH 8.0, containing at least 50 μg murine C5a. The exact amount is indicated on the label. Reconstitute the vial by pipetting 0.5 ml distilled or de-ionised water (Caution: vial is under vacuum).
Storage and stability
Lyophilized product should be stored at 4°C. Store stock solution after reconstitution in aliquots at -20°C. Repeated freeze and thaw cycles cause loss of activity. Under recommended storage conditions, product is stable for one year.
Precautions
For research use only. Not for use in or on humans or animals or for diagnostics. It is the responsibility of the user to comply with all local/state and Federal rules in the use of this product. Hycult Biotech is not responsible for any patent infringements that might result with the use of or derivation of this product.
Disease
Infectious diseases, Nephrology
CoA-TDS
HC1101
38 kb
Safety Data Sheet

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
HC4073-50UG
 50ug 
HM1065-20UG
 20ug 
HK354-01
 1x96det.