Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> COX15 Antibody - N-terminal region

COX15 Antibody - N-terminal region

Imprimer Imprimer
Identifiez-vous

Référence ARP46442_T100-25UL

Conditionnement : 25ul

Marque : Aviva Systems Biology

Demander plus d'informations

Contactez votre distributeur local :


Téléphone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-COX15 (ARP46442_T100) antibody
Product Info
Publications

Analysis of Oligomerization Properties of Heme a Synthase Provides Insights into Its Function in Eukaryotes. J. Biol. Chem. 291, 10411-25 (2016). 26940873

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human COX15
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Yeast: 82%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
Concentration1.0 mg/ml
Blocking PeptideFor anti-COX15 (ARP46442_T100) antibody is Catalog # AAP46442 (Previous Catalog # AAPS18308)
Sample Type Confirmation

COX15 is strongly supported by BioGPS gene expression data to be expressed in HepG2

ReferenceOquendo,C.E., (2004) J. Med. Genet. 41 (7), 540-544
Gene SymbolCOX15
Gene Full NameCOX15 homolog, cytochrome c oxidase assembly protein (yeast)
Alias SymbolsMC4DN6, CEMCOX2
NCBI Gene Id1355
Protein NameCytochrome c oxidase assembly protein COX15 homolog
Description of TargetCytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates several transcript variants diverging in the 3' region including alternate poly A sites. In total, 2 different isoforms are encoded by these variants.
Uniprot IDQ7KZN9-2
Protein Accession #NP_004367
Nucleotide Accession #NM_004376
Protein Size (# AA)388
Molecular Weight46 kDa
Protein InteractionsUBC; CLN3; MRPS14; NDUFA12; TOMM7; MRPL15; LAMTOR3; SURF1; NDUFS8; NDUFS6; NDUFS4; NDUFA9; CYC1;
Protein interactions
Name# of Products
CLN379
Biological process
Name# of Products
Cellular respiration12
Heme a biosynthetic process2
Mitochondrial electron transport, cytochrome c to oxygen2
Oxidation-reduction process160
Respiratory chain complex IV assembly5
Respiratory gaseous exchange25
Cellular components
Name# of Products
Integral to membrane2793
Membrane2769
Mitochondrial part3
Mitochondrial respiratory chain6
Protein function
Name# of Products
Catalytic activity298
Cytochrome-c oxidase activity22
Oxidoreductase activity, acting on the CH-CH group of donors6
Diseases
Name# of Products
Disease mutation5332
Leigh syndrome21

  1. What is the species homology for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COX15 Antibody - N-terminal region (ARP46442_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    This target may also be called "MC4DN6, CEMCOX2" in publications.

  5. What is the shipping cost for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "COX15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COX15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COX15"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COX15"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COX15"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COX15"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.