ITGA2 Antibody - C-terminal region

Référence ARP64290_P050-25UL

Conditionnement : 25ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Rating:
80% of 100
Datasheets/ManualsPrintable datasheet for anti-ITGA2 (ARP64290_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human ITGA2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF
Concentration0.5 mg/ml
Blocking PeptideFor anti-ITGA2 (ARP64290_P050) antibody is Catalog # AAP64290
Sample Type Confirmation

ITGA2 is supported by BioGPS gene expression data to be expressed in HT1080

Gene SymbolITGA2
Gene Full NameIntegrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Alias SymbolsBR, GPIa, CD49B, HPA-5, VLA-2, VLAA2
NCBI Gene Id3673
Protein NameIntegrin alpha-2
Description of TargetThis gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling.
Uniprot IDP17301
Protein Accession #NP_002194
Nucleotide Accession #NM_002203
Protein Size (# AA)1181
Molecular Weight126kDa
Protein InteractionsUBC; PDIA3; ATF2; ALB; ERGIC1; SHARPIN; ITGB1; PSMD4; AUP1; ITGA2; LAMA1; CD9; HSPG2; MMP1; COL8A1; COL1A2; COL1A1; ACTA1; RABIF; CD46;
  1. What is the species homology for "ITGA2 Antibody - C-terminal region (ARP64290_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "ITGA2 Antibody - C-terminal region (ARP64290_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ITGA2 Antibody - C-terminal region (ARP64290_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ITGA2 Antibody - C-terminal region (ARP64290_P050)"?

    This target may also be called "BR, GPIa, CD49B, HPA-5, VLA-2, VLAA2" in publications.

  5. What is the shipping cost for "ITGA2 Antibody - C-terminal region (ARP64290_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "ITGA2 Antibody - C-terminal region (ARP64290_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ITGA2 Antibody - C-terminal region (ARP64290_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "126kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ITGA2 Antibody - C-terminal region (ARP64290_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ITGA2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ITGA2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ITGA2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ITGA2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ITGA2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ITGA2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
OACA10166-50UG
 50ug 
OACA09875-50UG
 50ug 
OASA01247
 0.1mg