MCP1 (CCL2) (NM_002982) Human Recombinant Protein
Référence TP302180
Conditionnement : 20ug
MCP1 (CCL2) (NM_002982) Human Recombinant Protein
SKU
TP302180
Recombinant protein of human chemokine (C-C motif) ligand 2 (CCL2), 20 µg
- MVPro
Full-length human proteins expressed in HEK293T cells
In Stock*
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence | Protein Sequence >RC202180 protein sequence Red=Cloning site Green=Tags(s) MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIV AKEICADPKQKWVQDSMDHLDKQTQTPKT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002973 |
Locus ID | 6347 |
UniProt ID | P13500 |
Cytogenetics | 17q12 |
RefSeq Size | 760 |
RefSeq ORF | 297 |
Synonyms | GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF |
Summary | This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and basophils but not for neutrophils or eosinophils. It has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis and atherosclerosis. It binds to chemokine receptors CCR2 and CCR4. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS‐CoV‐2) infection. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway |
Write Your Own Review
FAQs |
|
SDS |
Recombinant Protein Resources |
SKU | Description | Size | ||
---|---|---|---|---|
PH302180 | CCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002973) | 10 ug | | |
LC401046 | CCL2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
LY401046 | Transient overexpression lysate of chemokine (C-C motif) ligand 2 (CCL2) | 100 ug | | |
TP723718 | Purified recombinant protein of Human chemokine (C-C motif) ligand 2 (CCL2 / MCP-1) | 10 ug | | |
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.