SMPX, Recombinant, Human, aa1-88, GST-Tag (Small Muscular Protein)

Référence 375341-100ug

Conditionnement : 100ug

Marque : US Biological

Demander plus d'informations

Contactez votre distributeur local :


Téléphone : +1 850 650 7790


375341 SMPX, Recombinant, Human, aa1-88, GST-Tag (Small Muscular Protein)

Clone Type
Polyclonal
Swiss Prot
Q9UHP9
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.||Source:|Recombinant protein corresponding to aa1-88 from human SMPX, fused to GST-Tag at N-terminal expressed in E. coli.||Molecular Weight: |~36.6kD||Amino Acid Sequence:|MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris, 50% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris, 50% glycerol.
Purity
≥90% (SDS-PAGE)
References
1. "Identification of a novel stretch-responsive skeletal muscle gene (Smpx)." Kemp T.J., Sadusky T.J., Simon M., Brown R., Eastwood M., Sassoon D.A., Coulton G.R. Genomics 72:260-271(2001).