Clinisciences > SRD5A2 Antibody - N-terminal region : HRP
SRD5A2 Antibody - N-terminal region : HRP
Référence ARP44265_P050-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
Demander plus d'informations
Veuillez vous connecter pour utiliser cette fonctionnalité.
Datasheets/Manuals | Printable datasheet for anti-SRD5A2 (ARP44265_P050) antibody |
---|
Publications | Bertin, J., Dury, A. Y., Ouellet, J., Pelletier, G. & Labrie, F. Localization of the androgen-synthesizing enzymes, androgen receptor, and sex steroids in the vagina: possible implications for the treatment of postmenopausal sexual dysfunction. J. Sex. Med. 11, 1949-61 (2014). 249195411$s> |
---|---|
Tested Species Reactivity | Human, Monkey |
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Monkey |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 77%; Pig: 93%; Rabbit: 86%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SRD5A2 (ARP44265_P050) antibody is Catalog # AAP44265 (Previous Catalog # AAPP25645) |
Gene Symbol | SRD5A2 |
---|---|
Gene Full Name | Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) |
Alias Symbols | MGC138457 |
NCBI Gene Id | 6716 |
Protein Name | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
Description of Target | This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). |
Uniprot ID | P31213 |
Protein Accession # | NP_000339 |
Nucleotide Accession # | NM_000348 |
Protein Size (# AA) | 254 |
Molecular Weight | 28kDa |
Biological pathways
Name | # of Products |
---|---|
Cell differentiation | 522 |
Sex differentiation | 29 |
Steroid metabolic process | 66 |
Biological process
Name | # of Products |
---|---|
Androgen biosynthetic process | 11 |
Androgen metabolic process | 13 |
Cell differentiation | 490 |
Cell-cell signaling | 235 |
Male gonad development | 78 |
Sex differentiation | 31 |
Small molecule metabolic process | 825 |
Steroid metabolic process | 76 |
Cellular components
Name | # of Products |
---|---|
Cytoplasm | 4549 |
Endoplasmic reticulum | 837 |
Endoplasmic reticulum membrane | 498 |
Integral to membrane | 2793 |
Membrane | 2769 |
Microsome | 250 |
Protein function
Name | # of Products |
---|---|
3-oxo-5-alpha-steroid 4-dehydrogenase activity | 8 |
Sterol 5-alpha reductase activity | 5 |
Diseases
Name | # of Products |
---|---|
Disease mutation | 5332 |
Pseudohermaphroditism | 48 |
- SRD5A2 Antibody - N-terminal region (ARP44264_P050)Catalog #: ARP44264_P050Species Tested: Human, MonkeyApplication: IHC, WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- SRD5A2 Antibody (OAEB01448)Catalog #: OAEB01448Application: WBFormat: Supplied at 0.5 mg/ml in Tris saline, 0.02% sodium azide, pH7.3 with 0.5% bovine serum albumin. Aliquot and store at -20°C. Minimize freezing and thawing.Size: 100UG
-
- SRD5A2 ELISA Kit (Mouse) (OKEH02519)Catalog #: OKEH02519Application: ELISA-SandwichKit Range: 0.156-10ng/mlSensitivity: 0.092 ng/mLSize: 96T
- SRD5A2 ELISA Kit (Rat) (OKEH03719)Catalog #: OKEH03719Application: ELISA-SandwichKit Range: 0.312-20ng/mLSensitivity: 0.184 ng/mLSize: 96T