TMF1 Antibody - middle region : HRP

Référence P100705_P050-HRP

Conditionnement : 100ul

Marque : Aviva Systems Biology

Demander plus d'informations

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

TMF1 Antibody - middle region (P100705_P050)

Datasheets/ManualsPrintable datasheet for anti-TMF1 (P100705_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TMF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: GNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-TMF1 (P100705_P050) antibody is Catalog # AAP31060 (Previous Catalog # AAPP01794)
Sample Type Confirmation

There is BioGPS gene expression data showing that TMF1 is expressed in MCF7

ReferenceYamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485
Gene SymbolTMF1
Gene Full NameTATA element modulatory factor 1
Alias SymbolsTMF, ARA160
NCBI Gene Id7110
Protein NameTATA element modulatory factor
Description of TargetTMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).
Uniprot IDP82094
Protein Accession #NP_009045
Nucleotide Accession #NM_007114
Protein Size (# AA)1093
Molecular Weight123kDa
Protein InteractionsUBC; NR3C1; GFI1B; ITSN2; KAT2B; PLK1; SMARCA4; AR; RAB6A; FER;