TSG101 Antibody - N-terminal region
Référence ARP33463_P050-25UL
Conditionnement : 25ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
TSG101 Antibody - N-terminal region (ARP33463_P050)
| Datasheets/Manuals | Printable datasheet for anti-TSG101 (ARP33463_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TSG101 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: YKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TSG101 (ARP33463_P050) antibody is Catalog # AAP33463 |
| Gene Symbol | TSG101 |
|---|---|
| Gene Full Name | tumor susceptibility gene 101 |
| Alias Symbols | TSG10, VPS23 |
| NCBI Gene Id | 7251 |
| Protein Name | Tumor susceptibility gene 101 protein |
| Description of Target | The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. |
| Uniprot ID | Q99816 |
| Protein Accession # | NP_006283 |
| Nucleotide Accession # | NM_006292 |
| Protein Size (# AA) | 390 |
| Molecular Weight | 44kDa |
| Protein Interactions | USHBP1; CEP55; VPS37C; VPS28; AATF; MGRN1; PDLIM7; TAX1BP1; KRT31; KRT13; KIFC3; DAPK3; AR; FAM9B; VPS37A; HAUS1; SYCE1; UBC; LRSAM1; ADRB2; MVB12A; UBAP1; CDKN1A; HGS; gag; gag-pol; GRB2; CDS2; ZFYVE9; VCP; VPS37B; WDR12; XPO1; UBD; ARRDC1; KCNN4; RAB11F |
