CDK6 MaxPab rabbit polyclonal antibody (D03)
* The price is valid only in USA. Please select country.
- More Files
- Specifications
Product Description
Rabbit polyclonal antibody raised against a full-length human CDK6 protein.
Immunogen
CDK6 (NP_001250.1, 1 a.a. ~ 326 a.a) full-length human protein.
Sequence
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDK6 expression in transfected 293T cell line (H00001021-T03) by CDK6 MaxPab polyclonal antibody.
Lane 1: CDK6 transfected lysate(35.86 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CDK6 transfected lysate using anti-CDK6 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CDK6 MaxPab mouse polyclonal antibody (B01) (H00001021-B01). - Gene Info — CDK6
Entrez GeneID
1021GeneBank Accession#
NM_001259.1Protein Accession#
NP_001250.1Gene Name
CDK6
Gene Alias
MGC59692, PLSTIRE, STQTL11
Gene Description
cyclin-dependent kinase 6
Omim ID
603368Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. [provided by RefSeq
Other Designations
cell division protein kinase 6
- Interactomes
- Pathways
- Diseases