CREB3L1 antibody - N-terminal region
Référence ARP36109_T100
Conditionnement : 100ul
Marque : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-CREB3L1 (ARP36109_T100) antibody |
---|
Publications | CREB3L1-mediated functional and structural adaptation of the secretory pathway in hormone-stimulated thyroid cells. J Cell Sci. 130, 4155-4167 (2017). 290930231$s> | ||
---|---|---|---|
Tested Species Reactivity | Human | ||
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit | ||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
Clonality | Polyclonal | ||
Host | Rabbit | ||
Application | WB | ||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L1 | ||
Purification | Protein A purified | ||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% | ||
Peptide Sequence | Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG | ||
Concentration | 1.0 mg/ml | ||
Blocking Peptide | For anti-CREB3L1 (ARP36109_T100) antibody is Catalog # AAP36109 (Previous Catalog # AAPP07437) | ||
Enhanced Validation |
|
Reference | Omori,Y., et al., (2002) Biochem. Biophys. Res. Commun. 293 (1), 470-477 |
---|---|
Gene Symbol | CREB3L1 |
Gene Full Name | CAMP responsive element binding protein 3-like 1 |
Alias Symbols | OI16, OASIS |
NCBI Gene Id | 90993 |
Protein Name | Cyclic AMP-responsive element-binding protein 3-like protein 1 |
Description of Target | The CREB3L1 gene encodes a protein with a transmembrane domain that is a transcriptional activator of the CREB/ATF family. |
Uniprot ID | Q96CP0 |
Protein Accession # | NP_443086 |
Nucleotide Accession # | NM_052854 |
Protein Size (# AA) | 519 |
Molecular Weight | 57kDa |
Protein Interactions | TMEM218; SLC30A8; MFSD5; SLC35B4; JAGN1; TMEM234; FXYD6; NRM; PGRMC1; FAM3C; TMEM147; PRKAB2; GPR25; RUNX1T1; C5; TSPO; Fbxw7; UBE2D3; UBA1; CREB3L1; CREB3L3; CREB3; DDIT3; CREM; |