Doublecortin (DCX) (NM_178151) Human Mass Spec Standard
Référence PH316349
Conditionnement : 10ug
Contactez votre distributeur local :
Doublecortin (DCX) (NM_178151) Human Mass Spec Standard
SKU
PH316349
DCX MS Standard C13 and N15-labeled recombinant protein (NP_835364)
3 Weeks*
| Product Data | |
| Tag | C-Myc/DDK |
|---|---|
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | [RC216349] |
| Predicted MW | 40 kDa |
| Protein Sequence | Protein Sequence >RC216349 protein sequence Red=Cloning site Green=Tags(s) MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVY AVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTK NVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQV LTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSA TAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSL DDSDSLGDSM myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
| Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_835364 |
| RefSeq Size | 9262 |
| RefSeq ORF | 1080 |
| Synonyms | DBCN; DC; LISX; SCLH; XLIS |
| Locus ID | 1641 |
| UniProt ID | O43602 |
| Cytogenetics | Xq23 |
| Summary | This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, cognitive disability, subcortical band heterotopia ("double cortex" syndrome) in females and lissencephaly ("smooth brain" syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010] |
| Protein Families | Druggable Genome |
Write Your Own Review
| FAQs |
|
| SDS |
Recombinant Protein Resources |
| SKU | Description | Size | ||
|---|---|---|---|---|
| PH306454 | DCX MS Standard C13 and N15-labeled recombinant protein (NP_835366) | 10 ug | | |
| PH321891 | DCX MS Standard C13 and N15-labeled recombinant protein (NP_835365) | 10 ug | | |
| LC403598 | DCX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC405947 | DCX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC406000 | DCX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC424646 | DCX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC434187 | DCX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LY403598 | Transient overexpression lysate of doublecortin (DCX), transcript variant 2 | 100 ug | | |
| LY405947 | Transient overexpression lysate of doublecortin (DCX), transcript variant 4 | 100 ug | | |
| LY406000 | Transient overexpression lysate of doublecortin (DCX), transcript variant 3 | 100 ug | | |
| LY424646 | Transient overexpression lysate of doublecortin (DCX), transcript variant 1 | 100 ug | | |
| LY434187 | Transient overexpression lysate of doublecortin (DCX), transcript variant 5 | 100 ug | | |
| TP306454 | Recombinant protein of human doublecortin (DCX), transcript variant 3, 20 µg | 20 ug | | |
| TP316349 | Recombinant protein of human doublecortin (DCX), transcript variant 4, 20 µg | 20 ug | | |
| TP321891 | Recombinant protein of human doublecortin (DCX), transcript variant 2, 20 µg | 20 ug | | |
| TP331188 | Purified recombinant protein of Homo sapiens doublecortin (DCX), transcript variant 5, 20 µg | 20 ug | | |
Related Products
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.