DTD2 Recombinant Protein
Référence OPCA02412-20UG
Conditionnement : 20ug
Marque : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for DTD2 Recombinant Protein (Human) (OPCA02412) (OPCA02412) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Human |
Additional Information | Relevance: Hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). Could be a defense mechanism against a harmful effect of D-tyrosine (Potential).Curated |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF |
Protein Sequence | MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-168 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | The DNA sequence and analysis of human chromosome 14.Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.Nature 421:601-607(2003) |
---|---|
Gene Symbol | DTD2 |
Gene Full Name | D-aminoacyl-tRNA deacylase 2 |
Alias Symbols | animalia-specifc tRNA deacylase;animalia-specific tRNA deacylase;ATD;C14orf126;D-aminoacyl-tRNA deacylase 2;D-tyrosyl-tRNA deacylase 2 (putative);D-tyrosyl-tRNA(Tyr) deacylase 2;L-alanyl-tRNA deacylase;probable D-tyrosyl-tRNA(Tyr) deacylase 2;putative D-tyrosyl-tRNA deacylase 2;putative D-tyrosyl-tRNA(Tyr) deacylase 2. |
NCBI Gene Id | 112487 |
Protein Name | D-aminoacyl-tRNA deacylase 2 |
Description of Target | Deacylates mischarged D-aminoacyl-tRNAs (By similarity). Probably acts by rejecting L-amino acids from its binding site rather than specific recognition of D-amino acids (By similarity). Catalyzes the hydrolysis of D-tyrosyl-tRNA(Tyr), has no activity on correctly charged L-tyrosyl-tRNA(Tyr) (By similarity). By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality. In contrast to DTD1, deacylates L-Ala mischarged on tRNA(Thr)(G4.U69) by alanine-tRNA ligase AARS (PubMed:29410408). Can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site (PubMed:29410408). Also hydrolyzes correctly charged, achiral, glycyl-tRNA(Gly) in vitro, although in vivo EEF1A1/EF-Tu may protect cognate achiral glycyl-tRNA(Gly) from DTD2-mediated deacetylation (By similarity). |
Uniprot ID | Q96FN9 |
Protein Accession # | NP_542395.1 |
Nucleotide Accession # | NM_080664.2 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 34.7 kDa |