GTF2B Antibody - N-terminal region : Biotin
Référence P100990_T100-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
GTF2B Antibody - N-terminal region (P100990_T100)
| Datasheets/Manuals | Printable datasheet for anti-GTF2B (P100990_T100) antibody |
|---|
| Tested Species Reactivity | Human, Rat |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2B |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-GTF2B (P100990_T100) antibody is Catalog # AAP31336 (Previous Catalog # AAPP02087) |
| Reference | Tubon,T.C., et al., (2004) Mol. Cell. Biol. 24 (7), 2863-2874 |
|---|---|
| Gene Symbol | GTF2B |
| Gene Full Name | General transcription factor IIB |
| Alias Symbols | TF2B, TFIIB |
| NCBI Gene Id | 2959 |
| Protein Name | Transcription initiation factor IIB |
| Description of Target | GTF2B is the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II. |
| Uniprot ID | Q00403 |
| Protein Accession # | NP_001505 |
| Nucleotide Accession # | NM_001514 |
| Protein Size (# AA) | 316 |
| Molecular Weight | 35kDa |
| Protein Interactions | DRAP1; TNIP1; UBC; FBXO25; HNF4A; TCEA1; GTF2F2; GTF2F1; DEPDC7; SLC22A2; RELA; POLR2C; JAK3; HMGCL; SMURF1; THRA; TBP; POLR2E; SRA1; LSM4; LSM5; CIITA; NXF1; POU3F2; EP300; PSMA3; POLR2J; ESR1; UL48; NR1D2; NCOR1; TAF9; REST; tat; SAP25; MKX; CTDP1; POLR |
