HSD3B1 Antibody - N-terminal region : Biotin
Référence ARP41821_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-HSD3B1 (ARP41821_P050) antibody |
---|
Publications | Dual targeting of androgen receptor and mTORC1 by salinomycin in prostate cancer. Oncotarget. 7, 62240-62254 (2016). 275574961$s> |
---|---|
Tested Species Reactivity | Human, Monkey |
Predicted Species Reactivity | Human, Goat, Monkey |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Goat: 82%; Human: 100%; Monkey: 92% |
Peptide Sequence | Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-HSD3B1 (ARP41821_P050) antibody is Catalog # AAP41821 (Previous Catalog # AAPP10869) |
Reference | Ross,R.W., (2008) J. Clin. Oncol. 26 (6), 842-847 |
---|---|
Gene Symbol | HSD3B1 |
Gene Full Name | Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 |
Alias Symbols | HSD3B, HSDB3, HSDB3A, SDR11E1, 3BETAHSD |
NCBI Gene Id | 3283 |
Protein Name | 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 |
Description of Target | 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. |
Uniprot ID | P14060 |
Protein Accession # | NP_000853 |
Nucleotide Accession # | NM_000862 |
Protein Size (# AA) | 373 |
Molecular Weight | 42kDa |