ISGF3G Antibody - N-terminal region
Référence ARP31200_P050-25UL
Conditionnement : 25ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
ISGF3G Antibody - N-terminal region (ARP31200_P050)
| Datasheets/Manuals | Printable datasheet for anti-IRF9 (ARP31200_P050) antibody |
|---|
| Publications | Bidwell, B. N. et al. Silencing of Irf7 pathways in breast cancer cells promotes bone metastasis through immune escape. Nat. Med. 18, 1224-31 (2012). 22820642 | ||||
|---|---|---|---|---|---|
| Tested Species Reactivity | Human | ||||
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish | ||||
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||
| Clonality | Polyclonal | ||||
| Host | Rabbit | ||||
| Application | IHC, WB | ||||
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ISGF3G | ||||
| Purification | Affinity Purified | ||||
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% | ||||
| Peptide Sequence | Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK | ||||
| Concentration | 0.5 mg/ml | ||||
| Blocking Peptide | For anti-IRF9 (ARP31200_P050) antibody is Catalog # AAP31200 (Previous Catalog # AAPS26406) | ||||
| Enhanced Validation |
|
| Reference | Lau,J.F., et al., (2003) Mol. Cell. Biol. 23 (2), 620-628 |
|---|---|
| Gene Symbol | IRF9 |
| Gene Full Name | Interferon regulatory factor 9 |
| Alias Symbols | p48, IRF-9, ISGF3, ISGF3G |
| NCBI Gene Id | 10379 |
| Protein Name | Interferon regulatory factor 9 |
| Description of Target | ISGF3G functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases. Defects in ISGF3 can cause resistance to IFN-.(2a) treatment. |
| Uniprot ID | Q00978 |
| Protein Accession # | NP_006075 |
| Nucleotide Accession # | NM_006084 |
| Protein Size (# AA) | 393 |
| Molecular Weight | 44 kDa |
| Protein Interactions | S100A13; MYO1F; TOP1; IRF1; IRF2BP1; DNMT3A; ELAVL1; STAT2; IFNAR2; CREBBP; DACH2; DMRTC2; TLX3; VENTX; ARID3B; NR2E3; POU2F1; HOXC9; TLX2; STAT1; IFNA1; RELA; NFKB1; |
