LGR5 Antibody : FITC

Référence ARP59640_P050-FITC

Conditionnement : 100ul

Marque : Aviva Systems Biology

Demander plus d'informations

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

LGR5 Antibody - middle region (ARP59640_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-LGR5 (ARP59640_P050) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 77%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolLGR5
Gene Full Nameleucine-rich repeat containing G protein-coupled receptor 5
Alias SymbolsFEX, HG38, GPR49, GPR67, GRP49
NCBI Gene Id8549
Protein NameLeucine-rich repeat-containing G-protein coupled receptor 5
Uniprot IDO75473
Protein Accession #NP_003658
Nucleotide Accession #NM_003667
Protein Size (# AA)907
Molecular Weight100 kDa
Protein InteractionsZnrf3;