LGR5 Antibody : FITC
Référence ARP59640_P050-FITC
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
LGR5 Antibody - middle region (ARP59640_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-LGR5 (ARP59640_P050) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 77%; Rabbit: 93%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | Available upon request |
| Gene Symbol | LGR5 |
|---|---|
| Gene Full Name | leucine-rich repeat containing G protein-coupled receptor 5 |
| Alias Symbols | FEX, HG38, GPR49, GPR67, GRP49 |
| NCBI Gene Id | 8549 |
| Protein Name | Leucine-rich repeat-containing G-protein coupled receptor 5 |
| Uniprot ID | O75473 |
| Protein Accession # | NP_003658 |
| Nucleotide Accession # | NM_003667 |
| Protein Size (# AA) | 907 |
| Molecular Weight | 100 kDa |
| Protein Interactions | Znrf3; |
