Mta2 Antibody - N-terminal region : HRP
Référence ARP37167_T100-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-Mta2 (ARP37167_T100) antibody |
---|
Tested Species Reactivity | Mouse |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 93%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 77% |
Peptide Sequence | Synthetic peptide located within the following region: YSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKV |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-Mta2 (ARP37167_T100) antibody is Catalog # AAP37167 (Previous Catalog # AAPP10730) |
Reference | Blackshaw,S., PLoS Biol. 2 (9), E247 (2004) |
---|---|
Gene Symbol | Mta2 |
Gene Full Name | Metastasis-associated gene family, member 2 |
Alias Symbols | Mta1, mmta, mmta2, Mta1l1, Mata1l1, AW550797 |
NCBI Gene Id | 23942 |
Protein Name | Metastasis-associated protein MTA2 |
Description of Target | MTA2 modulates the enzymatic activity of the histone deacetylase core complex. |
Uniprot ID | Q9R190 |
Protein Accession # | NP_035972 |
Nucleotide Accession # | NM_011842 |
Protein Size (# AA) | 668 |
Molecular Weight | 73kDa |
Protein Interactions | Eed; Nanog; L3mbtl2; Hdac1; Mta1; Satb2; Pou5f1; Runx1; RBBP7; RBBP4; Chd4; Mta2; Mbd3; Mbd2; Hdac2; Gata1; Sall4; Tfcp2l1; Esrrb; Zfpm1; |