Oct4 (POU5F1) (NM_002701) Human Mass Spec Standard

Référence PH311998

Conditionnement : 10ug

Demander plus d'informations

Contactez votre distributeur local :


Téléphone :

Oct4 (POU5F1) (NM_002701) Human Mass Spec Standard

Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211998]
Predicted MW 38.4 kDa
Protein Sequence
Protein Sequence
>RC211998 representing NM_002701
Red=Cloning site Green=Tags(s)

MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC
GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK
ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE
ADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN
RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV
TTLGSPMHSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Reference Data
RefSeq NP_002692
RefSeq Size 1417
RefSeq ORF 1080
Synonyms Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Locus ID 5460
UniProt ID Q01860
Cytogenetics 6p21.33
Summary This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq, Oct 2013]
Protein Families Adult stem cells, Cancer stem cells, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Transcription Factors
Write Your Own Review
You're reviewing:Oct4 (POU5F1) (NM_002701) Human Mass Spec Standard
Your Rating
SKU Description Size
LC400950 POU5F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC404373 POU5F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY400950 Transient overexpression lysate of POU class 5 homeobox 1 (POU5F1), transcript variant 1 100 ug
LY404373 Transient overexpression lysate of POU class 5 homeobox 1 (POU5F1), transcript variant 2 100 ug
TP311998 Recombinant protein of human POU class 5 homeobox 1 (POU5F1), transcript variant 1, 20 µg 20 ug
TP760938 Purified recombinant protein of Human POU class 5 homeobox 1 (POU5F1/OCT4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us