OS9 antibody

Référence orb579264-100ul

Conditionnement : 100ul

Marque : Biorbyt

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

    OS9 antibody

    Catalog Number: orb579264

    Catalog Numberorb579264
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to OS9
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityAnimal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
    ReactivityAnimal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
    ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human OS9
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW73kDa
    TargetOS9
    UniProt IDQ13438
    Protein SequenceSynthetic peptide located within the following region: LKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF
    NCBINP_006803
    StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesOS-9, ERLEC2
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    OS9 antibody

    Host: Rabbit, Target Name: OS9, Sample Type: Lung Tumor lysates, Antibody Dilution: 1.0 ug/ml.