Recombinant Human C-X-C Motif Chemokine 2/CXCL2
![](/proxy_img/aHR0cHM6Ly93d3cuYWJlb21pY3MuY29tL3Byb2R1Y3RfaW1hZ2UucGhwP3Bob3RvZmlsZT10ZW1wbGF0ZXMvYWJlb21pY3MvaW1hZ2VzL25vaW1hZ2UuanBn.jpg)
Conditionnement : 10ug
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 400mM NaCl, pH 8.5. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MTELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | The N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells. |
BioGrid: | 109177. 6 interactions. |
There are currently no product reviews |