RFX1 Antibody - C-terminal region : HRP
Référence P100690_P050-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
RFX1 Antibody - C-terminal region (P100690_P050)
| Datasheets/Manuals | Printable datasheet for anti-RFX1 (P100690_P050) antibody |
|---|
| Tested Species Reactivity | Human, Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RFX1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: ESEDELPQDISLAAGGESPALGPETLEPPAKLARTDARGLFVQALPSS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-RFX1 (P100690_P050) antibody is Catalog # AAP31034 (Previous Catalog # AAPP01767) |
| Reference | Wang,K.R., (2007) J. Biol. Chem. 282 (36), 26167-26177 |
|---|---|
| Gene Symbol | RFX1 |
| Gene Full Name | Regulatory factor X, 1 (influences HLA class II expression) |
| Alias Symbols | EFC, RFX |
| NCBI Gene Id | 5989 |
| Protein Name | MHC class II regulatory factor RFX1 |
| Description of Target | RFX1 is a member of the regulatory factor X protein family, which are transcription factors that contain a highly-conserved winged helix DNA binding domain. RFX1 is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P22670 |
| Protein Accession # | NP_002909 |
| Nucleotide Accession # | NM_002918 |
| Protein Size (# AA) | 979 |
| Molecular Weight | 105kDa |
| Protein Interactions | SOX2; SMAD9; SMAD4; SMAD1; NOTCH1; Cebpb; NCOA3; HDAC1; NFIC; NFIB; TADA3; RFX3; MAGED1; ABL1; NFIX; HMGB1; HIVEP2; RFX2; ADD1; |
