Small Proline-rich Protein 2B, Recombinant, Mouse, aa1-98, His-Tag, Myc-Tag

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).||Source:|Recombinant protein corresponding to aa1-98 from mouse Small proline-rich protein 2B, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus.||Molecular Weight: |~14.7kD||Amino Acid Sequence:|MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.