H00023418-A01 | CRB1 polyclonal antibody (A01) Clinisciences

Specifications

Product Description

Mouse polyclonal antibody raised against a partial recombinant CRB1.PAB,polyclonal Ab,polyclonal antibody

Immunogen

CRB1 (NP_036208, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag.

Sequence

FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVC

Host

Mouse

Reactivity

Human

Interspecies Antigen Sequence

Mouse (72); Rat (73)

Quality Control Testing

Antibody Reactive Against Recombinant Protein.

Western Blot detection against Immunogen (38.1 KDa) .

Storage Buffer

50 % glycerol

Storage Instruction

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications

Western Blot (Recombinant protein)

Protocol Download

ELISA

Gene Info

Entrez GeneID

23418

GeneBank Accession#

NM_012076

Protein Accession#

NP_036208

Gene Name

CRB1

Gene Alias

LCA8, RP12

Gene Description

crumbs homolog 1 (Drosophila)

Omim ID

172870 600105 604210

Gene Ontology

Hyperlink

Gene Summary

This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternatively spliced transcript variants have been observed but their full-length nature has yet to be determined. [provided by RefSeq

Other Designations

OTTHUMP00000033690|crumbs homolog 1

Interactomes

CRB1

Diseases

Publication Reference

Human CRB1 and CRB2 form homo- and heteromeric protein complexes in the retina.
Isabel F Stehle, Joel A Imventarza, Franziska Woerz, Felix Hoffmann, Karsten Boldt, Tina Beyer, Peter Mj Quinn, Marius Ueffing.

Life Science Alliance 2024 Apr; 7(6):e202302440.

Application：IF, Human, Retina, hiPSC-derived retinal organoids.
Characterization and AAV-mediated CRB gene augmentation in human-derived CRB1KO and CRB1KOCRB2+/- retinal organoids.
Nanda Boon, Xuefei Lu, Charlotte A Andriessen, Michaela Orlovà, Peter M J Quinn, Camiel J F Boon, Jan Wijnholds.

Molecular Therapy. Methods & Clinical Development 2023 Oct; 31:101128.

Application：IHC, Human, Retinal organoids.
AAV-mediated gene augmentation therapy of CRB1 patient-derived retinal organoids restores the histological and transcriptional retinal phenotype.
Nanda Boon, Xuefei Lu, Charlotte A Andriessen, Ioannis Moustakas, Thilo M Buck, Christian Freund, Christiaan H Arendzen, Stefan Böhringer, Hailiang Mei, Jan Wijnholds.

Stem Cell Reports 2023 May; 18(5):1123.

Application：IF, Human, Human retinal organoid.
Overexpression of Human CRB1 or Related Isoforms, CRB2 and CRB3, Does Not Regulate the Human Presenilin Complex in Culture Cells.
Pardossi-Piquard R, Chen F, Silva-Gagliardi NF, Szego M, McInnes R, McGlade CJ, George-Hyslop PS, Fraser PE.

Biochemistry 2007 Nov; 46(48):13704.

Application：IP-WB, Human, HEK 293 cells, Human retina tissue.

CRB1 polyclonal antibody (A01)

Katalog-Nummer H00023418-A01

Contact local distributor :

Marke : Abnova