CREB3L1 antibody - N-terminal region
Katalog-Nummer ARP36109_T100
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
CREB3L1 Antibody - N-terminal region (ARP36109_T100)
| Datasheets/Manuals | Printable datasheet for anti-CREB3L1 (ARP36109_T100) antibody |
|---|
| Publications | CREB3L1-mediated functional and structural adaptation of the secretory pathway in hormone-stimulated thyroid cells. J Cell Sci. 130, 4155-4167 (2017). 29093023 | ||
|---|---|---|---|
| Tested Species Reactivity | Human | ||
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit | ||
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
| Clonality | Polyclonal | ||
| Host | Rabbit | ||
| Application | WB | ||
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L1 | ||
| Purification | Protein A purified | ||
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% | ||
| Peptide Sequence | Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG | ||
| Concentration | 1.0 mg/ml | ||
| Blocking Peptide | For anti-CREB3L1 (ARP36109_T100) antibody is Catalog # AAP36109 (Previous Catalog # AAPP07437) | ||
| Enhanced Validation |
|
| Reference | Omori,Y., et al., (2002) Biochem. Biophys. Res. Commun. 293 (1), 470-477 |
|---|---|
| Gene Symbol | CREB3L1 |
| Gene Full Name | CAMP responsive element binding protein 3-like 1 |
| Alias Symbols | OI16, OASIS |
| NCBI Gene Id | 90993 |
| Protein Name | Cyclic AMP-responsive element-binding protein 3-like protein 1 |
| Description of Target | The CREB3L1 gene encodes a protein with a transmembrane domain that is a transcriptional activator of the CREB/ATF family. |
| Uniprot ID | Q96CP0 |
| Protein Accession # | NP_443086 |
| Nucleotide Accession # | NM_052854 |
| Protein Size (# AA) | 519 |
| Molecular Weight | 57kDa |
| Protein Interactions | TMEM218; SLC30A8; MFSD5; SLC35B4; JAGN1; TMEM234; FXYD6; NRM; PGRMC1; FAM3C; TMEM147; PRKAB2; GPR25; RUNX1T1; C5; TSPO; Fbxw7; UBE2D3; UBA1; CREB3L1; CREB3L3; CREB3; DDIT3; CREM; |
