Ctsd Antibody - C-terminal region : Biotin
Katalog-Nummer ARP41481_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for anti-Ctsd (ARP41481_P050) antibody |
|---|
| Publications | The late endocytic Rab39a GTPase regulates the interaction between multivesicular bodies and chlamydial inclusions. J. Cell. Sci. 128, 3068-81 (2015). 26163492 |
|---|---|
| Tested Species Reactivity | Human, Mouse |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Yeast: 92%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Ctsd (ARP41481_P050) antibody is Catalog # AAP41481 (Previous Catalog # AAPS09403) |
| Gene Symbol | Ctsd |
|---|---|
| Gene Full Name | Cathepsin D |
| Alias Symbols | CD, Cat, CatD |
| NCBI Gene Id | 13033 |
| Protein Name | Cathepsin D |
| Description of Target | Ctsd is an acid protease active in intracellular protein breakdown. |
| Uniprot ID | P18242 |
| Protein Accession # | NP_034113 |
| Nucleotide Accession # | NM_009983 |
| Protein Size (# AA) | 410 |
| Molecular Weight | 45kDa |
-
What is the species homology for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".
-
How long will it take to receive "Ctsd Antibody - C-terminal region (ARP41481_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "Ctsd Antibody - C-terminal region (ARP41481_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?
This target may also be called "CD, Cat, CatD" in publications.
-
What is the shipping cost for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "45kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CTSD"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CTSD"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CTSD"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CTSD"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CTSD"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CTSD"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.