ENO3 monoclonal antibody (M01A), clone 5D1
* The price is valid only in USA. Please select country.
- More Files
Western Blot (Cell lysate)
ENO3 monoclonal antibody (M01A), clone 5D1 Western Blot analysis of ENO3 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody (M01A), clone 5D1.
Lane 1: ENO3 transfected lysate(46.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (31.24 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant ENO3.
Immunogen
ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.24 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
ENO3 monoclonal antibody (M01A), clone 5D1 Western Blot analysis of ENO3 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody (M01A), clone 5D1.
Lane 1: ENO3 transfected lysate(46.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
- Gene Info — ENO3
Entrez GeneID
2027GeneBank Accession#
NM_001976Protein Accession#
NP_001967Gene Name
ENO3
Gene Alias
MSE
Gene Description
enolase 3 (beta, muscle)
Omim ID
131370Gene Ontology
HyperlinkGene Summary
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR. [provided by RefSeq
Other Designations
2-phospho-D-glycerate hydrolyase|ENO3, muscle enolase 3 beta|OTTHUMP00000125242|beta enolase|enolase 3|enolase-3, beta, muscle|muscle specific enolase|skeletal muscle enolase
- Interactomes
- Pathways
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Metabolic pathways
+ View More Disease
- Diseases