esxH Recombinant Protein
Katalog-Nummer OPCA02158-100UG
Size : 100ug
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for ESXH Recombinant Protein (Mycobacterium tuberculosis) (OPCA02158) (OPCA02158) |
---|
Predicted Species Reactivity | Mycobacterium tuberculosis |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Mycobacterium tuberculosis |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG |
Protein Sequence | SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 2-96 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains.Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. , Weidman J.F., Khouri H.M., Gill J., Mikula A., Bishai W., Jacobs W.R. Jr., Venter J.C., Fraser C.M.J. Bacteriol. 184:5479-5490(2002) |
---|---|
Gene Symbol | ESXH |
Alias Symbols | 10 kDa antigen CFP7;Low molecular weight protein antigen 7;Protein TB10.4. |
Protein Name | ESAT-6-like protein EsxH |
Description of Target | EsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery. |
Uniprot ID | P9WNK2 |
Protein Accession # | WP_003401514.1 |
Nucleotide Accession # | NZ_KK341227.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 26.3 kDa |