Fibronectin, Active, Recombinant, Human, aa1270-1546 & aa1721-2016 (FN1)

Katalog-Nummer 586900-10ug

Size : 10ug

Marke : US Biological

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790


586900 Fibronectin, Active, Recombinant, Human, aa1270-1546 & aa1721-2016 (FN1)

Clone Type
Polyclonal
Swiss Prot
P02751
Grade
Highly Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.||Partial recombinant protein corresponding to aa1270-1546 & aa1721-2016 from human Fibronectin, expressed in E.coli.||Molecular Weight:|~62.7kD||Biological Activity: |Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.1-0.5ug/ml.||Amino Acid Sequence:|PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS & AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST||Storage and Stability:|Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)|Concentration: ~0.1-1mg/ml (after reconstitution)|Form: Supplied as a lyophilized powder from 12.5mM sodium citrate, pH 6.2, 1.25% sucrose. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 12.5mM sodium citrate, pH 6.2, 1.25% sucrose. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Purity
≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)