GALP Antibody : FITC
Katalog-Nummer ARP63212_P050-FITC
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
GALP Antibody (ARP63212_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-GALP (ARP63212_P050) antibody |
|---|
| Predicted Species Reactivity | Human, Pig |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Pig: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | Available upon request |
| Gene Symbol | GALP |
|---|---|
| Gene Full Name | galanin-like peptide |
| NCBI Gene Id | 85569 |
| Protein Name | Galanin-like peptide |
| Description of Target | This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors. |
| Uniprot ID | Q9UBC7 |
| Protein Accession # | NP_149097 |
| Nucleotide Accession # | NM_001145546 |
| Protein Size (# AA) | 116 |
| Molecular Weight | 13 kDa |
