HIV-2 gp36 397 a.a is a recombinant viral antigen from human immunodeficiency virus.
Research Articles on HIV-2 gp36 397 a.a.
| Target | HIV-2 gp36 397 a.a. |
| Expression | Recombinant |
| Tested Applications | SDS-PAGE |
| Conjugation | Unconjugated |
| Form | Liquid |
| Purity | > 95% (SDS-PAGE and HPLC) |
| Sequence | EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC. |
| Specificity | Reactive with human HIV positive serum. |
| Availability | Shipped within 5-10 working days. |
| Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |