HSD17B11 Antibody - N-terminal region : HRP
Katalog-Nummer ARP40843_P050-HRP
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
HSD17B11 Antibody - N-terminal region (ARP40843_P050)
| Datasheets/Manuals | Printable datasheet for anti-HSD17B11 (ARP40843_P050) antibody |
|---|
| Tested Species Reactivity | Monkey |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Monkey |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B11 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HSD17B11 (ARP40843_P050) antibody is Catalog # AAP40843 (Previous Catalog # AAPY01095) |
| Gene Symbol | HSD17B11 |
|---|---|
| Gene Full Name | Hydroxysteroid (17-beta) dehydrogenase 11 |
| Alias Symbols | DHRS8, PAN1B, RETSDR2, SDR16C2, 17BHSD11, 17-BETA-HSD11, 17-BETA-HSDXI |
| NCBI Gene Id | 51170 |
| Protein Name | Estradiol 17-beta-dehydrogenase 11 |
| Description of Target | Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]). |
| Uniprot ID | Q8NBQ5 |
| Protein Accession # | NP_057329 |
| Nucleotide Accession # | NM_016245 |
| Protein Size (# AA) | 300 |
| Molecular Weight | 33kDa |
| Protein Interactions | FBXO6; UBD; UBC; ELAVL1; |
