KCNG1 polyclonal antibody
* The price is valid only in USA. Please select country.
- More Files
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with KCNG1 polyclonal antibody (Cat # PAB23557) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with KCNG1 polyclonal antibody (Cat # PAB23557) shows moderate cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with KCNG1 polyclonal antibody (Cat # PAB23557) at 1-4 ug/mL dilution shows positivity in vesicles.
- Specifications
Product Description
Rabbit polyclonal antibody raised against recombinant KCNG1.
Immunogen
Recombinant protein corresponding to amino acids of human KCNG1.
Sequence
MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with KCNG1 polyclonal antibody (Cat # PAB23557) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with KCNG1 polyclonal antibody (Cat # PAB23557) shows moderate cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with KCNG1 polyclonal antibody (Cat # PAB23557) at 1-4 ug/mL dilution shows positivity in vesicles. - Gene Info — KCNG1
Entrez GeneID
3755Protein Accession#
Q9UIX4Gene Name
KCNG1
Gene Alias
K13, KCNG, KV6.1, MGC12878, kH2
Gene Description
potassium voltage-gated channel, subfamily G, member 1
Omim ID
603788Gene Ontology
HyperlinkGene Summary
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Multiple alternatively spliced transcript variants have been found in normal and cancerous tissues. [provided by RefSeq
Other Designations
OTTHUMP00000043416|potassium channel KH2|potassium channel Kv6.1
- Interactomes
