Lixisenatide [320367-13-3]
Katalog-Nummer HY-P0119-1mg
Size : 1mg
Marke : MedChemExpress
Lixisenatide is a GLP-1 receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of proinflammatory cytokines, and blocks of cellular signaling pathways. Lixisenatide decreases atheroma plaque size and instability in Apoe−/− Irs2+/− mice by reprogramming macrophages towards an M2 phenotype, which leads to reduced inflammation.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
Kundenspezifische Peptidsynthese
Lixisenatide Chemische Struktur
CAS. Nr. : 320367-13-3
This product is a controlled substance and not for sale in your territory.
Based on 1 publication(s) in Google Scholar
Other Forms of Lixisenatide:
- Lixisenatide acetate In-stock
Alle MEK Isoform-spezifische Produkte anzeigen:
Alle Akt Isoform-spezifische Produkte anzeigen:
Alle MMP Isoform-spezifische Produkte anzeigen:
Alle JNK Isoform-spezifische Produkte anzeigen:
Beschreibung |
Lixisenatide is a GLP-1 receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of proinflammatory cytokines, and blocks of cellular signaling pathways. Lixisenatide decreases atheroma plaque size and instability in Apoe−/− Irs2+/− mice by reprogramming macrophages towards an M2 phenotype, which leads to reduced inflammation[2][3][5]. |
||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
IC50 & Target |
|
||||||||||||||||
In Vitro |
Lixisenatide (100 μM, 24 h) inhibits the Aβ25-35-induced cytotoxicity on cultured hippocampal cells. [1]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Cell Viability Assay[1]
Western Blot Analysis[3]
|
||||||||||||||||
In Vivo |
Lixisenatide (10 μg/kg, Subcutaneous injection, once a day for a month) diminishes the atherosclerosis burden and produces more stable plaques [2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
|
||||||||||||||||
Klinische Studie |
|
||||||||||||||||
Molekulargewicht |
4858.49 |
||||||||||||||||
Formel |
C215H347N61O65S |
||||||||||||||||
CAS. Nr. |
320367-13-3 |
||||||||||||||||
Appearance |
Solid |
||||||||||||||||
Color |
White to pink |
||||||||||||||||
Sequence |
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2 |
||||||||||||||||
Sequence Shortening |
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 |
||||||||||||||||
Versand | Room temperature in continental US; may vary elsewhere. |
||||||||||||||||
Speicherung |
Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||||||||||||
Lösungsmittel & Löslichkeit |
In Vitro:
H2O : 100 mg/mL (20.58 mM; Need ultrasonic) Preparing
Stock Solutions
View the Complete Stock Solution Preparation Table
*
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles. * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol) Concentration (start) × Volume (start) = Concentration (final) × Volume (final) This equation is commonly abbreviated as: C1V1 = C2V2 In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
Dosage mg/kgAnimal weight Dosing volume Number of animals Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration:
mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
|
||||||||||||||||
Reinheit & Dokumentation | |||||||||||||||||
Verweise |
|
Complete Stock Solution Preparation Table
*
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
---|
H2O | 1 mM | 0.2058 mL | 1.0291 mL | 2.0583 mL | 5.1456 mL |
5 mM | 0.0412 mL | 0.2058 mL | 0.4117 mL | 1.0291 mL | |
10 mM | 0.0206 mL | 0.1029 mL | 0.2058 mL | 0.5146 mL | |
15 mM | 0.0137 mL | 0.0686 mL | 0.1372 mL | 0.3430 mL | |
20 mM | 0.0103 mL | 0.0515 mL | 0.1029 mL | 0.2573 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Lixisenatide Related Classifications
- Neurological Disease Metabolic Disease Inflammation/Immunology
- GPCR/G Protein MAPK/ERK Pathway PI3K/Akt/mTOR Metabolic Enzyme/Protease
- GCGR MEK Akt MMP JNK