MAPK12 (Mitogen-activated Protein Kinase 12, MAPK 12, MAP Kinase 12, PRKM12, Extracellular Signal-regulated Kinase 6, ERK6, ERK-6, Mitogen-activated Protein Kinase p38 gamma, MAP Kinase p38 gamma, P38gamma, Stress-activated Protein Kinase 3, SAPK3, SAPK-3) (PE)
Katalog-Nummer 129399-PE-100ul
Size : 100ul
Marke : US Biological
129399-PE MAPK12 (Mitogen-activated Protein Kinase 12, MAPK 12, MAP Kinase 12, PRKM12, Extracellular Signal-regulated Kinase 6, ERK6, ERK-6, Mitogen-activated Protein Kinase p38 gamma, MAP Kinase p38 gamma, P38gamma, Stress-activated Protein Kinase 3, SAPK3, SAPK-3) (PE)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E IF WBCrossreactivity
HuAccession #
BC015741, AAH15741.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeMAPK12, belongs to the MAP kinase family. MAPK12 functions as a signal transducer during differentiation of myoblasts to myotubes. Expressed in different areas throughout the body with common expression patterns in heart, p38 proteins use magnesium as a cofactor to catalyze the ATP-dependent phosphorylation of target proteins.||Applications:|Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested.||Recommended Dilution:|Immunofluorescence: 10ug/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQS||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note: Applications are based on unconjugated antibody.