MSH2 Antibody - N-terminal region : FITC
Katalog-Nummer ARP41350_T100-FITC
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
MSH2 Antibody - N-terminal region (ARP41350_T100)
| Datasheets/Manuals | Printable datasheet for anti-MSH2 (ARP41350_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MSH2 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-MSH2 (ARP41350_T100) antibody is Catalog # AAP41350 (Previous Catalog # AAPS01509) |
| Reference | Hoss,M. EMBO J.(1999) 18 (13), 3868-3875 |
|---|---|
| Gene Symbol | MSH2 |
| Gene Full Name | MutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) |
| Alias Symbols | FCC1, COCA1, HNPCC, LCFS2, hMSH2, HNPCC1, MMRCS2 |
| NCBI Gene Id | 4436 |
| Protein Name | DNA mismatch repair protein Msh2 |
| Description of Target | MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. |
| Uniprot ID | P43246 |
| Protein Accession # | AAY15096 |
| Nucleotide Accession # | NM_000251 |
| Protein Size (# AA) | 586 |
| Molecular Weight | 64kDa |
| Protein Interactions | ESR1; BRCA1; SUMO2; RPA3; RPA2; RPA1; REV1; POLK; DPYSL3; ATP6V1B2; CUL2; XRCC5; SUPT5H; STAT3; ST13; PDE3A; NRD1; JUP; XRCC6; SEC23A; HDAC6; PCNA; MSH3; MSH6; ERCC4; ERCC1; gag-pol; UBC; SUPT16H; SEPT9; SRSF10; SRSF11; SART1; SMARCA5; TOP2B; SRSF7; SRSF5 |
