MSH2 Antibody - N-terminal region : HRP
Katalog-Nummer ARP41350_T100-HRP
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-MSH2 (ARP41350_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MSH2 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-MSH2 (ARP41350_T100) antibody is Catalog # AAP41350 (Previous Catalog # AAPS01509) |
Reference | Hoss,M. EMBO J.(1999) 18 (13), 3868-3875 |
---|---|
Gene Symbol | MSH2 |
Gene Full Name | MutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) |
Alias Symbols | FCC1, COCA1, HNPCC, LCFS2, hMSH2, HNPCC1, MMRCS2 |
NCBI Gene Id | 4436 |
Protein Name | DNA mismatch repair protein Msh2 |
Description of Target | MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. |
Uniprot ID | P43246 |
Protein Accession # | AAY15096 |
Nucleotide Accession # | NM_000251 |
Protein Size (# AA) | 586 |
Molecular Weight | 64kDa |
Protein Interactions | ESR1; BRCA1; SUMO2; RPA3; RPA2; RPA1; REV1; POLK; DPYSL3; ATP6V1B2; CUL2; XRCC5; SUPT5H; STAT3; ST13; PDE3A; NRD1; JUP; XRCC6; SEC23A; HDAC6; PCNA; MSH3; MSH6; ERCC4; ERCC1; gag-pol; UBC; SUPT16H; SEPT9; SRSF10; SRSF11; SART1; SMARCA5; TOP2B; SRSF7; SRSF5 |