NR2C1 Antibody - middle region : Biotin
Katalog-Nummer P100813_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
NR2C1 Antibody - middle region (P100813_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-NR2C1 (P100813_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NR2C1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 80%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: ELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHIFK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-NR2C1 (P100813_P050) antibody is Catalog # AAP31157 (Previous Catalog # AAPP01896) |
| Sample Type Confirmation | NR2C1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Reference | Lin,Y.L., (2006) Biochem. Biophys. Res. Commun. 350 (2), 430-436 |
|---|---|
| Gene Symbol | NR2C1 |
| Gene Full Name | Nuclear receptor subfamily 2, group C, member 1 |
| Alias Symbols | TR2 |
| NCBI Gene Id | 7181 |
| Protein Name | Nuclear receptor subfamily 2 group C member 1 |
| Description of Target | The nuclear orphan receptors NR2C1 represses transcription and binds DNA as a homodimer. NR2C1 binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism. NR2C1 may function as a negative modulator to suppress androgen receptor function in prostate cancer. NR2C1 may exert an important repressor in regulating ER activity in mammary glands. The nuclear orphan receptors TR2 (NR2C1) and TR4 form a heterodimer that binds to the epsilon and gamma globin promoter DR1 sites This gene encodes a nuclear hormone receptor characterized by a highly conserved DNA binding domain (DBD), a variable hinge region, and a carboxy-terminal ligand binding domain (LBD) that is typical for all members of the steroid/thyroid hormone receptor superfamily. This protein also belongs to a large family of ligand-inducible transcription factors that regulate gene expression by binding to specific DNA sequences within promoters of target genes. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these variants has not been determined. |
| Uniprot ID | Q15625 |
| Protein Accession # | NP_003288 |
| Nucleotide Accession # | NM_003297 |
| Protein Size (# AA) | 603 |
| Molecular Weight | 67kDa |
| Protein Interactions | PSPC1; MBD3; SIN3A; RCOR1; KDM1A; POLD3; TRIM28; RBM39; MTA2; MTA1; HDAC3; NR2C2; SMARCA4; SFPQ; RBBP7; RBBP4; NONO; HDAC2; HDAC1; HCFC1; DNMT1; CHD4; NUDT3; UBC; PML; HDAC4; NRIP1; AR; ESR1; |
