POU3F2 Antibody - C-terminal region : FITC
Katalog-Nummer P100858_P050-FITC
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-POU3F2 (P100858_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Rat, Cow, Pig |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Human: 100%; Pig: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-POU3F2 (P100858_P050) antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964) |
Reference | Goodall,J., (2004) Mol. Cell. Biol. 24 (7), 2923-2931 |
---|---|
Gene Symbol | POU3F2 |
Gene Full Name | POU class 3 homeobox 2 |
Alias Symbols | BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7, N-Oct3 |
NCBI Gene Id | 5454 |
Protein Name | POU domain, class 3, transcription factor 2 |
Description of Target | N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM]. |
Uniprot ID | P20265 |
Protein Accession # | NP_005595 |
Nucleotide Accession # | NM_005604 |
Protein Size (# AA) | 443 |
Molecular Weight | 47kDa |
Protein Interactions | UBC; TBP; SOX10; POU3F2; PAX3; GTF2B; EP300; SOX11; PQBP1; POU3F4; |