POU3F2 Antibody - C-terminal region : FITC

Katalog-Nummer P100858_P050-FITC

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

POU3F2 Antibody - C-terminal region (P100858_P050)

Datasheets/ManualsPrintable datasheet for anti-POU3F2 (P100858_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Human: 100%; Pig: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
Concentration0.5 mg/ml
Blocking PeptideFor anti-POU3F2 (P100858_P050) antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964)
ReferenceGoodall,J., (2004) Mol. Cell. Biol. 24 (7), 2923-2931
Gene SymbolPOU3F2
Gene Full NamePOU class 3 homeobox 2
Alias SymbolsBRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7, N-Oct3
NCBI Gene Id5454
Protein NamePOU domain, class 3, transcription factor 2
Description of TargetN-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM].
Uniprot IDP20265
Protein Accession #NP_005595
Nucleotide Accession #NM_005604
Protein Size (# AA)443
Molecular Weight47kDa
Protein InteractionsUBC; TBP; SOX10; POU3F2; PAX3; GTF2B; EP300; SOX11; PQBP1; POU3F4;