PTDSS2 antibody - N-terminal region

Katalog-Nummer ARP49960_P050

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

PTDSS2 Antibody - N-terminal region (ARP49960_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-PTDSS2 (ARP49960_P050) antibody
Product Info
Publications

Deficient Endoplasmic Reticulum-Mitochondrial Phosphatidylserine Transfer Causes Liver Disease. Cell. 177, 881-895.e17 (2019). 31051106

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PTDSS2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: GQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-PTDSS2 (ARP49960_P050) antibody is Catalog # AAP49960 (Previous Catalog # AAPP44252)
Sample Type Confirmation

PTDSS2 is supported by BioGPS gene expression data to be expressed in HEK293T

Gene SymbolPTDSS2
Gene Full NamePhosphatidylserine synthase 2
Alias SymbolsPSS2
NCBI Gene Id81490
Protein NamePhosphatidylserine synthase 2
Description of TargetPhosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell signaling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS2, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]).
Uniprot IDQ9BVG9
Protein Accession #NP_110410
Nucleotide Accession #NM_030783
Protein Size (# AA)487
Molecular Weight56kDa
Protein InteractionsHNRNPR; ILF3; UBC;