TA342472 | Rabbit Polyclonal Anti-METT10D Antibody Clinisciences

METT10D (METTL16) Rabbit Polyclonal Antibody

SKU

TA342472

Rabbit Polyclonal Anti-METT10D Antibody

Specifications
Product Data
Application	WB
Recommended Dilution	WB
Reactivity	Human
Antibody Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for anti-METT10D antibody: synthetic peptide directed towards the N terminal of human METT10D. Synthetic peptide located within the following region: LNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIH
Buffer	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Shipping	Blue Ice
Predicted Protein Size	63 kDa
Gene Name	methyltransferase like 16
Database Link	NP_076991 Q86W50
Background	Probable methyltransferase.
Synonyms	METT10D
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data

Product Manuals
Goat anti-Mouse IgG [H&L] Western Blotting Luminol Kit
FAQs
Antibody and Western Standard
SDS
SDS for TA342472

Antibody Resources
Product Overview Video: TrueMAB Video Tutorial: Video Tutorial: Antibody specificity and Knockout(KO) lysates Western Blot Protocol IHC Protocol IF Protocol FACS Protocol Immunoprecipitation (IP) Protocol IP protocol with magnetic beads