TA337564 | Rabbit Polyclonal Anti-NR2C2AP Antibody Clinisciences

TRA16 (NR2C2AP) Rabbit Polyclonal Antibody

SKU

TA337564

Rabbit Polyclonal Anti-NR2C2AP Antibody

Specifications
Product Data
Application	WB
Recommended Dilution	WB
Reactivity	Human
Antibody Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for anti-NR2C2AP antibody: synthetic peptide directed towards the N terminal of human NR2C2AP. Synthetic peptide located within the following region: THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL
Buffer	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Shipping	Blue Ice
Predicted Protein Size	16 kDa
Gene Name	nuclear receptor 2C2 associated protein
Database Link	NP_795361 Q86WQ0
Background	NR2C2AP may act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.
Synonyms	TRA16
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome

Product Manuals
Goat anti-Mouse IgG [H&L] Western Blotting Luminol Kit
FAQs
Antibody and Western Standard
SDS
SDS for TA337564

Antibody Resources
Product Overview Video: TrueMAB Video Tutorial: Video Tutorial: Antibody specificity and Knockout(KO) lysates Western Blot Protocol IHC Protocol IF Protocol FACS Protocol Immunoprecipitation (IP) Protocol IP protocol with magnetic beads