Rala Antibody - N-terminal region
Katalog-Nummer ARP56642_P050-25UL
Size : 25ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-Rala (ARP56642_P050) antibody |
---|
Tested Species Reactivity | Rat |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rala |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: AANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-Rala (ARP56642_P050) antibody is Catalog # AAP56642 |
Gene Symbol | Rala |
---|---|
Gene Full Name | v-ral simian leukemia viral oncogene homolog A (ras related) |
Alias Symbols | - |
NCBI Gene Id | 81757 |
Protein Name | Ras-related protein Ral-A |
Description of Target | Rala is a putative GTP binding protein. |
Uniprot ID | P63322 |
Protein Accession # | NP_112355 |
Nucleotide Accession # | NM_031093 |
Protein Size (# AA) | 206 |
Molecular Weight | 22kDa |
Protein Interactions | Ubc; Ralbp1; Ybx3; CSDA; Exoc8; |