RBPMS antibody - N-terminal region
Katalog-Nummer ARP40269_T100
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-RBPMS (ARP40269_T100) antibody |
---|
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB, ICC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RBPMS |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-RBPMS (ARP40269_T100) antibody is Catalog # AAP40269 (Previous Catalog # AAPP23471) |
Reference | Rual,J.F., (2005) Nature 437 (7062), 1173-1178 |
---|---|
Gene Symbol | RBPMS |
Gene Full Name | RNA binding protein with multiple splicing |
Alias Symbols | HERMES |
NCBI Gene Id | 11030 |
Protein Name | RNA binding protein with multiple splicing EMBL AAH92476.1 |
Description of Target | RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.This gene encodes a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. The protein encoded by this gene has a single, putative RRM domain in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Uniprot ID | Q93062 |
Protein Accession # | NP_001008712 |
Nucleotide Accession # | NM_001008712 |
Protein Size (# AA) | 219 |
Molecular Weight | 24kDa |
Protein Interactions | CRBN; ILF3; DOK6; ZNF385C; TEX37; WDR90; PAPD4; TOR1AIP2; ATP6V0E2; SH3RF2; DCDC2B; LOC148413; MGAT5B; SPATA8; RDH12; LOC142937; GLYCTK; NEU4; C22orf39; LRRC75A-AS1; PRR20A; ZNF488; DTX2; NAPRT; HNRNPLL; RIPPLY1; LONRF1; FBF1; C1orf94; ZC3H10; C9orf24; LI |