SCMH1 Antibody - middle region
Katalog-Nummer ARP31693_P050-25UL
Size : 25ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-SCMH1 (ARP31693_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Yeast |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SCMH1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 86%; Yeast: 79% |
Peptide Sequence | Synthetic peptide located within the following region: LTGDNLQPPGTKVVIPKNPYPASDVNTEKPSIHSSTKTVLEHQPGQRGRK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SCMH1 (ARP31693_P050) antibody is Catalog # AAP31693 (Previous Catalog # AAPP02480) |
Reference | Olsen,J.V., (2006) Cell 127 (3), 635-648 |
---|---|
Gene Symbol | SCMH1 |
Gene Full Name | Sex comb on midleg homolog 1 (Drosophila) |
Alias Symbols | Scml3 |
NCBI Gene Id | 22955 |
Protein Name | Polycomb protein SCMH1 |
Description of Target | SCMH1 is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. |
Uniprot ID | Q96GD3-4 |
Protein Accession # | NP_036368 |
Nucleotide Accession # | NM_012236 |
Protein Size (# AA) | 591 |
Molecular Weight | 65kDa |
Protein Interactions | UBQLN1; RNF2; MAGEA12; BMI1; UBQLN4; PHC3; CBX4; PCGF2; PHC2; PHC1; MAML3; LZTR1; PCBD1; EWSR1; TMEM11; SCMH1; MOB4; TOB1; POLR2M; LYPLA2; GMNN; HK1; Cbx2; |