SLC2A2 Antibody - N-terminal region : FITC

Katalog-Nummer ARP41706_P050-FITC

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

SLC2A2 Antibody - N-terminal region (ARP41706_P050)

Datasheets/ManualsPrintable datasheet for anti-SLC2A2 (ARP41706_P050) antibody
Product Info
Publications

Maternal Heat Stress Alters Expression of Genes Associated with Nutrient Transport Activity and Metabolism in Female Placentae from Mid-Gestating Pigs. Int J Mol Sci. 22 (2021). 33923747

Mechanism of insulin resistance in a rat model of kidney disease and the risk of developing type 2 diabetes. PLoS One. 12, e0176650 (2017). 28459862

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC2A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 79%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 92%
Peptide SequenceSynthetic peptide located within the following region: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC2A2 (ARP41706_P050) antibody is Catalog # AAP41706 (Previous Catalog # AAPP24349)
ReferenceLaukkanen,O., (2005) Diabetes 54 (7), 2256-2260
Gene SymbolSLC2A2
Gene Full NameSolute carrier family 2 (facilitated glucose transporter), member 2
Alias SymbolsGLUT2
NCBI Gene Id6514
Protein NameSolute carrier family 2, facilitated glucose transporter member 2
Description of TargetGlucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.
Uniprot IDP11168
Protein Accession #NP_000331
Nucleotide Accession #NM_000340
Protein Size (# AA)524
Molecular Weight58kDa
Protein InteractionsAPP; PRKACA; PDX1; KPNA2; HNRNPL;