CLDN1 antibody - C-terminal region

Katalog-Nummer ARP33623_P050

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

CLDN1 Antibody - C-terminal region (ARP33623_P050)

Datasheets/ManualsPrintable datasheet for anti-CLDN1 (ARP33623_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CLDN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
Concentration0.5 mg/ml
Blocking PeptideFor anti-CLDN1 (ARP33623_P050) antibody is Catalog # AAP33623 (Previous Catalog # AAPP04679)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceCoyne,C.B., et al., (2003) Am. J. Physiol. Lung Cell Mol. Physiol. 285 (5), L1166-L1178
Gene SymbolCLDN1
Gene Full NameClaudin 1
Alias SymbolsCLD1, SEMP1, ILVASC
NCBI Gene Id9076
Protein NameClaudin-1
Description of TargetTight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This protein, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.
Uniprot IDO95832
Protein Accession #NP_066924
Nucleotide Accession #NM_021101
Protein Size (# AA)211
Molecular Weight23 kDa
Protein InteractionsUBC; DRG1; LNX1; TJP3; BRD4; MPDZ; TJP2; CLDN1; INADL; CLDN3; WNK4; TJP1; MMP14; MMP2; CLDN5;