CLDN1 antibody - C-terminal region
Katalog-Nummer ARP33623_P050
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-CLDN1 (ARP33623_P050) antibody |
---|
Tested Species Reactivity | Human | ||||||
---|---|---|---|---|---|---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep | ||||||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||||
Clonality | Polyclonal | ||||||
Host | Rabbit | ||||||
Application | IHC, WB | ||||||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||||
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN1 | ||||||
Purification | Affinity Purified | ||||||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 100% | ||||||
Peptide Sequence | Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV | ||||||
Concentration | 0.5 mg/ml | ||||||
Blocking Peptide | For anti-CLDN1 (ARP33623_P050) antibody is Catalog # AAP33623 (Previous Catalog # AAPP04679) | ||||||
Enhanced Validation |
|
Reference | Coyne,C.B., et al., (2003) Am. J. Physiol. Lung Cell Mol. Physiol. 285 (5), L1166-L1178 |
---|---|
Gene Symbol | CLDN1 |
Gene Full Name | Claudin 1 |
Alias Symbols | CLD1, SEMP1, ILVASC |
NCBI Gene Id | 9076 |
Protein Name | Claudin-1 |
Description of Target | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This protein, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. |
Uniprot ID | O95832 |
Protein Accession # | NP_066924 |
Nucleotide Accession # | NM_021101 |
Protein Size (# AA) | 211 |
Molecular Weight | 23 kDa |
Protein Interactions | UBC; DRG1; LNX1; TJP3; BRD4; MPDZ; TJP2; CLDN1; INADL; CLDN3; WNK4; TJP1; MMP14; MMP2; CLDN5; |