HOXD12 Antibody - middle region : HRP

Katalog-Nummer ARP31967_P050-HRP

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

HOXD12 Antibody - middle region (ARP31967_P050)

Datasheets/ManualsPrintable datasheet for anti-HOXD12 (ARP31967_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HOXD12
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: AGVASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFIN
Concentration0.5 mg/ml
Blocking PeptideFor anti-HOXD12 (ARP31967_P050) antibody is Catalog # AAP31967 (Previous Catalog # AAPP02864)
ReferenceZhao,X., (2007) Am. J. Hum. Genet. 80 (2), 361-371
Gene SymbolHOXD12
Gene Full NameHomeobox D12
Alias SymbolsHOX4H
NCBI Gene Id3238
Protein NameHomeobox protein Hox-D12
Description of TargetHOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP35452
Protein Accession #NP_067016
Nucleotide Accession #NM_021193
Protein Size (# AA)270
Molecular Weight29kDa
Protein InteractionsTRAF1; CREBBP; MAFF; MAFG; MEIS1; MAFB; MAFK; MAF;