Matrix Protein, Recombinant, Rabies Virus, aa1-202, His-Tag (M)
Katalog-Nummer 374157-100ug
Size : 100ug
Marke : US Biological
374157 Matrix Protein, Recombinant, Rabies Virus, aa1-202, His-Tag (M)
Clone Type
PolyclonalSwiss Prot
P15200Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CPlays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons.||Source:|Recombinant protein corresponding to aa1-202 from rabies virus M, fused to His-Tag at N-terminal, expressed in Yeast.||Molecular Weight: |~25.2kD||Amino Acid Sequence:|MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.