SPIB Antibody - C-terminal region : HRP

Katalog-Nummer ARP31422_P050-HRP

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

SPIB Antibody - C-terminal region (ARP31422_P050)

Datasheets/ManualsPrintable datasheet for anti-SPIB (ARP31422_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SPIB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA
Concentration0.5 mg/ml
Blocking PeptideFor anti-SPIB (ARP31422_P050) antibody is Catalog # AAP31422 (Previous Catalog # AAPP03080)
Sample Type Confirmation

SPIB is supported by BioGPS gene expression data to be expressed in Daudi

ReferenceGeng,C.D. (2005) J. Biol. Chem. 280 (52), 43264-43271
Gene SymbolSPIB
Gene Full NameSpi-B transcription factor (Spi-1/PU.1 related)
Alias SymbolsSPI-B
NCBI Gene Id6689
Protein NameTranscription factor Spi-B
Description of TargetSPI1 (MIM 165170) and SPIB are members of a subfamily of ETS (see ETS1; MIM 164720) transcription factors. ETS proteins share a conserved ETS domain that mediates specific DNA binding. SPIB and SPI1 bind to a purine-rich sequence, the PU box (5-prime-GAGGAA-3-prime).
Uniprot IDQ01892
Protein Accession #NP_003112
Nucleotide Accession #NM_003121
Protein Size (# AA)177
Molecular Weight19kDa
Protein InteractionsTMEM37; SSB; GATA1; IRF4; MAPK3; MAPK8; CREBBP; TBP; CEBPB; RB1; SPI1; JUN; CSNK2A2; CSNK2A1; SPIB; E2F4; E2F3; E2F2; E2F1;